PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00050377001
Common NameGSBRNA2T00050377001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 345aa    MW: 36902.6 Da    PI: 9.3107
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00050377001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.11.9e-3895152461
               zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            l+cprC+s+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk+
  GSBRNA2T00050377001  95 GPLNCPRCNSANTKFCYFNNYNLTQPRHFCKACRRYWTQGGALRNVPVGGGCRRNKKA 152
                          5789***************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-3378148IPR003851Zinc finger, Dof-type
PfamPF027011.5E-3296151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.58197151IPR003851Zinc finger, Dof-type
PROSITE patternPS01361099135IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFSSVSSFL DPPINWPQSA NSNNHPNHPH QLHLQETGNL VGGHQVHSHQ FPPQNPNPNH  60
NHVDTTADTT VDPAGLSGPA TERARLAKNS HPPEGPLNCP RCNSANTKFC YFNNYNLTQP  120
RHFCKACRRY WTQGGALRNV PVGGGCRRNK KAKPGNSKSS ASSQNKQSTS MVNASSPTTN  180
SNIQLRTNSQ LPFLPTLQNL TQLGGIGLNL AAINGNSVGN GNTSSSFFND LGFFHGANTS  240
GPVMANNNNN ESNIMTSLGS ASHFAMLDRS MGLYSFPNEG NMVLSSSTAS RVSQTAPVKM  300
EETHVGNISR PDSGLTSAGN QSNQYWPGLT LPGSSSNDQQ QHLM*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.276820.0seed
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00050377001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009140944.10.0PREDICTED: dof zinc finger protein DOF2.2 isoform X1
SwissprotQ9ZV331e-175DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLA0A078GZ370.0A0A078GZ37_BRANA; BnaA04g16710D protein
STRINGBra035667.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-140Dof family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]